Tuesday, April 25, 2017 Register

8er Options Overview

8er Options (definition): Factory equipment added to the vehicle over and above the standard and "series" offering (see Vehicle Build Sheet (VBS) for more information).

  • Data provided.  The table to the right represents the aggregated data for Options produced by the BMW factory for the 8 Series. 

Options data was pulled from each individual 8 Series build sheet.  From 30,621 build sheets, the data was analyzed either by country option codes (also known as Market Versions) or by specific Vehicle Identification Numbers (VINs) per country.   

Added 2011-02-26: Totals count for each option. The number given in the rightmost column corres-ponds to the number of E31´s with this option code. Option codes marked with an asterisk have been reassigned at a later date and may appear with the new assignment on a current options data printout.


Models covered in this summary:
M60 830Ci/840Ci, M62 840Ci, M70 850Ci, M73 850Ci, and S70 850CSi

Source: BMW AG; BMW 8 Series Inventory Project
Date: 19-December-2009
Prepared by: JG Spencer

Addendum: 26-February-2011
  Prepared by: R Wolf

8er Options List

Browse records in that    Search     
CodeDescriptionBeschreibungDetailTotals/Anzahl
199EQUIPMENT FOR LEADED FUELAUSFUEHRUNG FUER VERBLEITEN KRAFTSTOFFWITHOUT CATALYTIC CONVERTER1119
202STEPTRONICSTEPTRONICSTEPTRONIC 5SPD TRANSMISSIONSeries
211DYNAMIC STABILITY CONTROLDYNAMISCHE-STABILITAETS-CONTROLDYNAMIC STABILITY CONTROL117
214AUTOMATIC STABILITY CONTROL+TRACTIONAUT.STABIL.-CONTROL+TRAKTION (ASC+T)ASC+T AUTOMATIC STABILITY CONTROL5705
216SERVOTRONICSERVOTRONICHYDRO STEERING-SERVOTRONIC2933
223ELECTRONIC DAMPER CONTROL (EDC)ELEKTRONISCHE DAEMPFER CONTROL (EDC)ELECTRONIC DAMPER CONTROL (EDC)7837
226SPORTS SUSPENSION SETTINGSSPORTLICHE FAHRWERKSABSTIMMUNGSPORT SUSPENSION SETTINGS708
228*COMFORT SUSPENSIONKOMFORT FAHRWERKSABSTIMMUNGCOMFORT SUSPENSION SETTINGS41
235TRAILER-HITCH WITH REMOVABLE HEADANHAENGERKUPPLUNG - KOPF ABNEHMBARTOWING HITCH, DETACHABLE314
237DYNAMIC DRIVE PACKAGEFAHRDYNAMIK-SYSTEMDRIVING DYNAMICS PACKAGE (AHK)450
240LEATHER STEERING WHEELLEDERLENKRADLEATHER STEERING WHEEL W AIRBAG12371
241AIRBAG FOR DRIVER AND PASSENGERAIRBAG FAHRER UND BEIFAHRERDRIVER AND PASSENGER AIRBAG6090
243AIRBAG FOR FRONT PASSENGERAIRBAG FUER BEIFAHRERAIRBAG FOR FRONT PASSENGER3133
245STEERING COLUMN ADJUSTMENT ELECLENKSAEULENVERSTELLUNG ELEKTRISCHSTEERING WHEEL COLUMN ADJUSTMENT,ELECTR.20847
255SPORTS LEATHER STEERING WHEELSPORT-LEDERLENKRAD AIRBAGSPORT STEERING WHEEL W/AIRBAG2091
260*FLAT TIRE WARNING SYSTEMREIFENPANNEN-WARNSYSTEM (RDC)FLAT TIRE WARNING SYSTEM (Prototype)11
298*BMW LM RAD/TURBINENSTYLINGBMW LM RAD/TURBINENSTYLINGBMW LA WHEEL TURBINE STYLING7757
299LT/ALY WHEELS W MIXED TYRESLM RAEDER MIT MISCHBEREIFUNGBMW LA WHEELS WITH MIXED TIRES; CROSS-SPOKE,COMPOSITE WHEEL (STYL.5)2914
301*ALARM SYSTEMSDIEBSTAHLWARNANLAGE MIT ZVALARM SYSTEMS10618
302ALARM SYSTEMALARMANLAGEALARM SYSTEM W REMOTE CONTROL4492
303*BURGLAR AL. WITH TILT ALARM SENSORINNENRAUMSCHUTZ/NEIGUNGSALARMGEBERBURGLAR AL. WITH TILT ALARM SENSOR7466
320MODEL DESIGNATION, DELETIONMODELLSCHRIFTZUG ENTFALLDELETED, MODEL LETTERING5193
337M SPORTS PACKAGEM SPORTPAKETM TECHNIC SPORT PACKAGE892
353ANTI-GLARE STRIP FRONT + RR WINDOWGRUENKEIL - FRONT- UND HECKSCHEIBEFRONT AND REAR WINDOW GREEN WEDGE10613
357*ANTI GLARE STRIP CLEAR FRONT WINDOWGRUENKEIL - FRONTSCHEIBE KLARCLEAR GLASS ON FRONT WINDOW W ANTI GLARE STRIP152
Page 1 of 8First   Previous   [1]  2  3  4  5  6  7  8  Next   Last   
These options were installed on a number of 8er's during its production run.

Republishing content is expressly prohibited.
Note: information available via US English only; other languages will be added later.
Build Summary|Chassis|Market Version|Options|Year|Worldwide Shipments | Terms Of Use | Privacy Statement
©Copyright 2002-2016 8Coupe.com - All Worldwide Rights Reserved